PDB entry 1tte

View 1tte on RCSB PDB site
Description: The Structure of a Class II ubiquitin-conjugating enzyme, Ubc1.
Class: ligase
Keywords: Ubc1, E2, ubiquitin-dependent degradation, LIGASE
Deposited on 2004-06-22, released 2004-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2-24 kda
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: UBC1, YDR177W, YD9395.10
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21734 (0-214)
      • engineered (0)
      • engineered (92)
    Domains in SCOPe 2.08: d1ttea1, d1ttea2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tteA (A:)
ssrakrimkeiqavkddpaahitlefvsesdihhlkgtflgppgtpyeggkfvvdievpm
eypfkppkmqfdtkvyhpnissvtgaicldilrnawspvitlksalislqallqspepnd
pqdaevaqhylrdresfnktaalwtrlyasetsngqkgnveesdlygidhdlidefesqg
fekdkivevlrrlgvksldpndnntanriieellk