PDB entry 1ttb

View 1ttb on RCSB PDB site
Description: the x-ray crystal structure refinements of normal human transthyretin and the amyloidogenic val30met variant to 1.7 angstroms resolution
Class: transport(thyroxine)
Keywords: transport(thyroxine)
Deposited on 1992-11-02, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-126)
      • conflict (108)
    Domains in SCOPe 2.08: d1ttba_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-126)
      • conflict (108)
    Domains in SCOPe 2.08: d1ttbb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ttbA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiatllspysystta
    vvtnpke
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ttbB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiatllspysystta
    vvtnpke