PDB entry 1tt2

View 1tt2 on RCSB PDB site
Description: Cryogenic crystal structure of Staphylococcal nuclease variant truncated Delta+PHS I92K
Class: hydrolase
Keywords: hydrolase
Deposited on 2004-06-21, released 2004-07-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.189
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered (43-44)
      • engineered (85)
      • engineered (110)
      • engineered (117)
      • engineered (121)
    Domains in SCOPe 2.05: d1tt2a_
  • Heterogens: CA, DMS, THP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tt2A (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglaykyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsedn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tt2A (A:)
    klhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakk
    ievefdkgqrtdkygrglaykyadgkmvnealvrqglakvayvykgnntheqllrkaeaq
    akkeklniws