PDB entry 1tsu

View 1tsu on RCSB PDB site
Description: crystal structure of decamer ncp1 substrate peptide in complex with wild-type d25n hiv-1 protease variant
Class: Viral protein/hydrolase
Keywords: co-evolution, nucleocapdis, substrate recognition, hiv-1 protease
Deposited on 2004-06-21, released 2005-03-29
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.207
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pol polyprotein
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
    • engineered (24)
  Domains in SCOP 1.75: d1tsua1
• Chain 'B':
  Compound: Pol polyprotein
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
    • engineered (24)
  Domains in SCOP 1.75: d1tsub1
• Chain 'P':
  Compound: nc-p1 substrate peptide
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04591 (0-7)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tsuA (A:)
  pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tsuB (B:)
  pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'P':
  No sequence available.