PDB entry 1tsk

View 1tsk on RCSB PDB site
Description: scorpion toxin (ts kappa) from tityus serrulatus active on small conductance potassium channel, nmr, 30 structures
Class: neurotoxin
Keywords: scorpion, toxin, tityus serrulatus, potassium channel, ts kapa, neurotoxin
Deposited on 1997-02-05, released 1997-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ts kapa
  Species: Tityus serrulatus [TaxId:6887]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56219 (0-34)
  Domains in SCOPe 2.08: d1tska_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tskA (A:)
  vvigqrcyrspdcysackklvgkatgkctngrcdc