PDB entry 1tsi

View 1tsi on RCSB PDB site
Description: structure of the complex between trypanosomal triosephosphate isomerase and n-hydroxy-4-phosphono-butanamide: binding at the active site despite an "open" flexible loop
Class: isomerase(intramolecular oxidoreductse)
Keywords: isomerase(intramolecular oxidoreductse)
Deposited on 1992-11-19, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.84 Å
R-factor: 0.115
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Trypanosoma brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tsia_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Trypanosoma brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tsib_
  • Heterogens: 4PB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tsiA (A:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalirswvsskigadvrgelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tsiA (A:)
    skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
    iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
    mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
    qaqeahalirswvsskigadvrgelrilyggsvngknartlyqqrdvngflvggaslkpe
    fvdiikatq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tsiB (B:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalirswvsskigadvrgelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tsiB (B:)
    skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
    iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
    mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
    qaqeahalirswvsskigadvrgelrilyggsvngknartlyqqrdvngflvggaslkpe
    fvdiikatq