PDB entry 1tsh

View 1tsh on RCSB PDB site
Description: tertiary structures of three amyloidogenic transthyretin variants and implications for amyloid fibril formation
Class: transport
Keywords: thyroid hormone, liver, plasma, cerebrospinal fluid, polyneuropathy, disease mutation, transport, thyroxine
Deposited on 1996-10-16, released 1997-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.189
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-126)
      • variant (59)
    Domains in SCOPe 2.08: d1tsha_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-126)
      • variant (59)
    Domains in SCOPe 2.08: d1tshb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tshA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglta
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tshB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglta
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke