PDB entry 1tsg

View 1tsg on RCSB PDB site
Description: nmr study of the link module from tsg-6, minimized average structure
Deposited on 1996-03-08, released 1997-04-01
The last revision prior to the SCOP 1.61 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1tsg__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tsg_ (-)
  gvyhrearsgkykltyaeakavcefegghlatykqleaarkigfhvcaagwmakgrvgyp
  ivkpgpncgfgktgiidygirlnrserwdaycynphak