PDB entry 1tsf

View 1tsf on RCSB PDB site
Description: Crystal Structure of the Archaeal homolog of Human RNase P Protein Rpp29 from Archaeoglobus fulgidus
Deposited on 2004-06-21, released 2004-10-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-12, with a file datestamp of 2004-10-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.25
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tsfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tsfA (A:)
    mrgrlqgveliardwiglmvevvespnhsevgikgevvdetqntlkimtekglkvvakrg
    rtfrvwykgkimrikgdlinfrpedrikrglmmlkrakgvwi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tsfA (A:)
    qgveliardwiglmvevvespnhsevgikgevvdetqntlkimtekglkvvakrgrtfrv
    wykgkimrikgdlinfrpedr