PDB entry 1tsa

View 1tsa on RCSB PDB site
Description: the mutant met121ala of pseudomonas aeruginosa azurin and its azide derivative, crystal structures and spectral properties
Class: electron transport
Keywords: copper protein
Deposited on 1995-09-22, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 1996-03-08, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: PSEUDOMONAS AERUGINOSA
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (120)
    Domains in SCOPe 2.07: d1tsaa_
  • Chain 'B':
    Compound: Azurin
    Species: PSEUDOMONAS AERUGINOSA
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (120)
    Domains in SCOPe 2.07: d1tsab_
  • Chain 'C':
    Compound: Azurin
    Species: PSEUDOMONAS AERUGINOSA
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (120)
    Domains in SCOPe 2.07: d1tsac_
  • Chain 'D':
    Compound: Azurin
    Species: PSEUDOMONAS AERUGINOSA
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (120)
    Domains in SCOPe 2.07: d1tsad_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tsaA (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    akgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tsaB (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    akgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tsaC (C:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    akgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tsaD (D:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    akgtltlk