PDB entry 1ts9

View 1ts9 on RCSB PDB site
Description: Crystal Structure of the Archaeal Homolog of Human RNase P Protein Rpp29 from Archaeoglobus fulgidus
Class: hydrolase
Keywords: anti-parallel, beta-sheet, alpha helix, internal salt bridge, selenomethionine, Sm-fold
Deposited on 2004-06-21, released 2004-10-12
The last revision prior to the SCOP 1.73 freeze date was dated 2005-03-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.204
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease P protein component 1
    Species: Archaeoglobus fulgidus
    Gene: RNP1, AF1917
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28362 (Start-101)
      • modified residue (18)
      • modified residue (47)
      • modified residue (71)
      • modified residue (91-92)
    Domains in SCOP 1.73: d1ts9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ts9A (A:)
    mrgrlqgveliardwiglmvevvespnhsevgikgevvdetqntlkimtekglkvvakrg
    rtfrvwykgkimrikgdlinfrpedrikrglmmlkrakgvwi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ts9A (A:)
    lqgveliardwiglmvevvespnhsevgikgevvdetqntlkimtekglkvvakrgrtfr
    vwykgkimrikgdlinfrpedrikrglmmlkrakgvwi