PDB entry 1ts8

View 1ts8 on RCSB PDB site
Description: Structure of the pR cis planar intermediate from time-resolved Laue crystallography
Class: photoreceptor
Keywords: photoreceptor
Deposited on 2004-06-21, released 2005-07-05
The last revision prior to the SCOP 1.75 freeze date was dated 2005-07-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.356
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Photoactive yellow protein
  Species: Halorhodospira halophila
  Gene: PYP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16113 (0-124)
  Domains in SCOP 1.75: d1ts8a1
• Heterogens: HC4

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ts8A (A:)
  mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
  nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
  fvkrv