PDB entry 1ts5

View 1ts5 on RCSB PDB site
Description: i140t mutant of toxic shock syndrome toxin-1 from s. aureus
Class: toxin
Keywords: toxin, superantigen
Deposited on 1997-10-10, released 1998-12-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.179
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toxic shock syndrome toxin-1
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06886
      • see remark 999 (115)
      • engineered (139)
    Domains in SCOPe 2.06: d1ts5a1, d1ts5a2
  • Chain 'B':
    Compound: toxic shock syndrome toxin-1
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06886 (0-193)
      • see remark 999 (115)
      • engineered (139)
    Domains in SCOPe 2.06: d1ts5b1, d1ts5b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ts5A (A:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhqltqthglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ts5B (B:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhqltqthglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein