PDB entry 1ts3

View 1ts3 on RCSB PDB site
Description: h135a mutant of toxic shock syndrome toxin-1 from s. aureus
Class: toxin
Keywords: toxin, superantigen
Deposited on 1997-10-10, released 1998-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.26
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toxic shock syndrome toxin-1
    Species: Staphylococcus aureus [TaxId:1280]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06886
      • see remark 999 (115)
      • engineered (134)
    Domains in SCOPe 2.07: d1ts3a1, d1ts3a2
  • Chain 'B':
    Compound: toxic shock syndrome toxin-1
    Species: Staphylococcus aureus [TaxId:1280]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06886
      • see remark 999 (115)
      • engineered (134)
    Domains in SCOPe 2.07: d1ts3b1, d1ts3b2
  • Chain 'C':
    Compound: toxic shock syndrome toxin-1
    Species: Staphylococcus aureus [TaxId:1280]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06886 (0-193)
      • see remark 999 (115)
      • engineered (134)
    Domains in SCOPe 2.07: d1ts3c1, d1ts3c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ts3A (A:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeiraqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ts3B (B:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeiraqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ts3C (C:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeiraqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein