PDB entry 1trz

View 1trz on RCSB PDB site
Description: crystallographic evidence for dual coordination around zinc in the t3r3 human insulin hexamer
Class: hormone
Keywords: hormone
Deposited on 1993-11-19, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.172
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.07: d1trz.1
• Chain 'B':
  Compound: insulin
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOPe 2.07: d1trz.1
• Chain 'C':
  Compound: insulin
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.07: d1trz.2
• Chain 'D':
  Compound: insulin
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOPe 2.07: d1trz.2
• Heterogens: ZN, CL, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1trzA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1trzB (B:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1trzC (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1trzD (D:)
  fvnqhlcgshlvealylvcgergffytpkt