PDB entry 1trw

View 1trw on RCSB PDB site
Description: the high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin
Deposited on 1994-05-10, released 1994-09-30
The last revision prior to the SCOP 1.69 freeze date was dated 1994-09-30, with a file datestamp of 1994-10-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.69: d1trw__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1trw_ (-)
  mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
  daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv