PDB entry 1trq

View 1trq on RCSB PDB site
Description: x-ray crystallographic and calorimeric studies of the effects of the mutation trp 59 tyr in ribonuclease t1
Deposited on 1993-07-06, released 1994-04-30
The last revision prior to the SCOP 1.59 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.16
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1trqa_
  • Chain 'B':
    Domains in SCOP 1.59: d1trqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1trqA (A:)
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyeyp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1trqB (B:)
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyeyp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect