PDB entry 1trn

View 1trn on RCSB PDB site
Description: crystal structure of human trypsin 1: unexpected phosphorylation of tyrosine 151
Class: hydrolase (serine proteinase)
Keywords: human trypsin, dfp inhibited, hydrolase (serine proteinase)
Deposited on 1995-03-16, released 1995-06-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.177
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1trna_
  • Chain 'B':
    Compound: Trypsin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1trnb_
  • Heterogens: ISP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1trnA (A:)
    ivggynceensvpyqvslnsgyhfcggslineqwvvsaghcyksriqvrlgehnievleg
    neqfinaakiirhpqydrktlnndimliklssravinarvstislptappatgtkclisg
    wgntassgadypdelqcldapvlsqakceasypgkitsnmfcvgfleggkdscqgdsggp
    vvcngqlqgvvswgdgcaqknkpgvytkvynyvkwikntiaans
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1trnB (B:)
    ivggynceensvpyqvslnsgyhfcggslineqwvvsaghcyksriqvrlgehnievleg
    neqfinaakiirhpqydrktlnndimliklssravinarvstislptappatgtkclisg
    wgntassgadypdelqcldapvlsqakceasypgkitsnmfcvgfleggkdscqgdsggp
    vvcngqlqgvvswgdgcaqknkpgvytkvynyvkwikntiaans