PDB entry 1trl

View 1trl on RCSB PDB site
Description: nmr solution structure of the c-terminal fragment 255-316 of thermolysin: a dimer formed by subunits having the native structure
Class: hydrolase (metalloprotease)
Keywords: hydrolase (metalloprotease)
Deposited on 1994-09-02, released 1995-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thermolysin fragment 255 - 316
  Species: Bacillus thermoproteolyticus [TaxId:1427]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00800 (0-61)
  Domains in SCOPe 2.08: d1trla_
• Chain 'B':
  Compound: thermolysin fragment 255 - 316
  Species: Bacillus thermoproteolyticus [TaxId:1427]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00800 (0-61)
  Domains in SCOPe 2.08: d1trlb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1trlA (A:)
  vvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygstsqevasvkqafdavg
  vk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1trlB (B:)
  vvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygstsqevasvkqafdavg
  vk