PDB entry 1trk

View 1trk on RCSB PDB site
Description: refined structure of transketolase from saccharomyces cerevisiae at 2.0 angstroms resolution
Deposited on 1993-11-22, released 1994-04-30
The last revision prior to the SCOP 1.59 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 2 Å
R-factor: 0.157
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1trkA (A:)
    qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
    fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
    snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
    iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
    likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
    kpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrkls
    etvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygirehamg
    aimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpthq
    pietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssiesa
    skggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqpleyr
    lsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaeraqk
    tiafykgdklisplkkaf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1trkB (B:)
    qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
    fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
    snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
    iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
    likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
    kpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrkls
    etvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygirehamg
    aimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpthq
    pietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssiesa
    skggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqpleyr
    lsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaeraqk
    tiafykgdklisplkkaf