PDB entry 1trk

View 1trk on RCSB PDB site
Description: refined structure of transketolase from saccharomyces cerevisiae at 2.0 angstroms resolution
Class: transferase(ketone residues)
Keywords: transferase(ketone residues)
Deposited on 1993-11-22, released 1994-04-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.157
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transketolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1trka1, d1trka2, d1trka3
  • Chain 'B':
    Compound: transketolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1trkb1, d1trkb2, d1trkb3
  • Heterogens: CA, TPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1trkA (A:)
    mtqftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinr
    drfvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgq
    gisnavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnl
    iaiyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdk
    ptlikmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqkt
    ilkpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrk
    lsetvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygireha
    mgaimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpt
    hqpietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssie
    saskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqple
    yrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaera
    qktiafykgdklisplkkaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1trkA (A:)
    qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
    fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
    snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
    iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
    likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
    kpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrkls
    etvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygirehamg
    aimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpthq
    pietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssiesa
    skggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqpleyr
    lsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaeraqk
    tiafykgdklisplkkaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1trkB (B:)
    mtqftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinr
    drfvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgq
    gisnavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnl
    iaiyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdk
    ptlikmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqkt
    ilkpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrk
    lsetvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygireha
    mgaimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpt
    hqpietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssie
    saskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqple
    yrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaera
    qktiafykgdklisplkkaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1trkB (B:)
    qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
    fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
    snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
    iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
    likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
    kpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrkls
    etvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygirehamg
    aimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpthq
    pietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssiesa
    skggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqpleyr
    lsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaeraqk
    tiafykgdklisplkkaf