PDB entry 1tri

View 1tri on RCSB PDB site
Description: the crystal structure of an engineered monomeric triosephosphate isomerase, monotim: the correct modelling of an eight-residue loop
Class: isomerase(intramolecular oxidoreductase)
Keywords: isomerase(intramolecular oxidoreductase)
Deposited on 1993-10-08, released 1994-07-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.165
AEROSPACI score: -1.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (Start-242)
      • engineered (67-71)
      • engineered (73-74)
    Domains in SCOPe 2.01: d1tria_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1triA (A:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnagnadalaslkdfgvnwivlghserrayygetneivadkvaaavasgfmviaci
    getlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeah
    alirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiik
    atq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1triA (A:)
    skpqpiaaanwgsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfviaa
    qnagnadalaslkdfgvnwivlghserrayygetneivadkvaaavasgfmviacigetl
    qeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahalir
    swvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiikatq