PDB entry 1trf

View 1trf on RCSB PDB site
Description: solution structure of the tr1c fragment of skeletal muscle troponin-c
Class: muscle protein
Keywords: muscle protein
Deposited on 1993-12-29, released 1994-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: troponin c
  Species: Meleagris gallopavo [TaxId:9103]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10246 (0-75)
  Domains in SCOPe 2.06: d1trfa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1trfA (A:)
  aflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiieevdedgsg
  tidfeeflvmmvrqmk