PDB entry 1trf

View 1trf on RCSB PDB site
Description: solution structure of the tr1c fragment of skeletal muscle troponin-c
Deposited on 1993-12-29, released 1994-10-15
The last revision prior to the SCOP 1.57 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1trf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1trf_ (-)
    aflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiieevdedgsg
    tidfeeflvmmvrqmk