PDB entry 1tre

View 1tre on RCSB PDB site
Description: the structure of triosephosphate isomerase from escherichia coli determined at 2.6 angstrom resolution
Class: intramolecular oxidoreductase
Keywords: intramolecular oxidoreductase
Deposited on 1992-10-12, released 1993-10-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.119
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1trea_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1treb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1treA (A:)
    mrhplvmgnwklngsrhmvhelvsnlrkelagvagcavaiappemyidmakreaegshim
    lgaqnvnlnlsgaftgetsaamlkdigaqyiiighserrtyhkesdeliakkfavlkeqg
    ltpvlcigeteaeneagkteevcarqidavlktqgaaafegaviayepvwaigtgksatp
    aqaqavhkfirdhiakvdaniaeqviiqyggsvnasnaaelfaqpdidgalvggaslkad
    afavivkaaeaakqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1treB (B:)
    mrhplvmgnwklngsrhmvhelvsnlrkelagvagcavaiappemyidmakreaegshim
    lgaqnvnlnlsgaftgetsaamlkdigaqyiiighserrtyhkesdeliakkfavlkeqg
    ltpvlcigeteaeneagkteevcarqidavlktqgaaafegaviayepvwaigtgksatp
    aqaqavhkfirdhiakvdaniaeqviiqyggsvnasnaaelfaqpdidgalvggaslkad
    afavivkaaeaakqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1treB (B:)
    mrhplvmgnwklngsrhmvhelvsnlrkelagvagcavaiappemyidmakreaegshim
    lgaqnvnlnlsgaftgetsaamlkdigaqyiiighserrtyhkesdeliakkfavlkeqg
    ltpvlcigeteaeneagkteevcarqidavlktqgaaafegaviayepvwaigtgksatp
    aqaqavhkfirdhiakvdaniaeqviiqyggsvnasnaaelfaqpdidgalvggaslkad
    afavivkaaeaak