PDB entry 1tr9

View 1tr9 on RCSB PDB site
Description: Structure of beta-hexosaminidase from Vibrio cholerae
Class: hydrolase
Keywords: beta-alpha barrel, Beta-hexosaminidase, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, HYDROLASE
Deposited on 2004-06-21, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hexosaminidase
    Species: Vibrio cholerae [TaxId:666]
    Gene: Name=nagZ; OrderedLocusNames=VC0692;
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KU37 (2-End)
      • cloning artifact (0-1)
      • modified residue (101)
      • modified residue (120)
      • modified residue (150)
      • modified residue (155)
      • modified residue (188)
      • modified residue (203-204)
      • modified residue (246)
      • modified residue (252)
      • modified residue (269)
      • modified residue (289)
      • modified residue (321)
    Domains in SCOPe 2.07: d1tr9a1, d1tr9a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tr9A (A:)
    slgplwldvagyelsaedreilqhptvggvilfgrnyhdnqqllalnkairqaakrpili
    gvdqeggrvqrfregfsrippaqyyaraengvelaeqggwlmaaeliahdvdlsfapvld
    mgfackaignrafgedvqtvlkhssaflrgmkavgmattgkhfpghgaviadshletpyd
    eretiaqdmaifraqieagvldammpahvvyphydaqpasgssywlkqvlreelgfkgiv
    fsddlsmegaavmggpvershqalvagcdmilicnkreaavevldnlpimevpqaeallk
    kqqfsyselkrlerwqqasanmqrlieqfseeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr9A (A:)
    slgplwldvagyelsaedreilqhptvggvilfgrnyhdnqqllalnkairqaakrpili
    gvdqeggrvqrfregfsrippaqyyaraengvelaeqggwlmaaeliahdvdlsfapvld
    mgfackaignrafgedvqtvlkhssaflrgmkavgmattgkhfpghgaviadshletpyd
    eretiaqdmaifraqieagvldammpahvvyphydaqpasgssywlkqvlreelgfkgiv
    fsddlsmegaavmggpvershqalvagcdmilicnkreaavevldnlpimevpqaeallk
    kqqfsyselkrlerwqqasanmqrlieqfs