PDB entry 1tr4

View 1tr4 on RCSB PDB site
Description: Solution structure of human oncogenic protein gankyrin
Class: unknown function
Keywords: gankyrin, oncoprotein, ankyrin repeats, NMR, protein structure, UNKNOWN FUNCTION
Deposited on 2004-06-19, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 26S proteasome non-ATPase regulatory subunit 10
    Species: Homo sapiens [TaxId:9606]
    Gene: Psmd10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tr4A (A:)
megcvsnlmvcnlaysgkleelkesiladkslatrtdqdsrtalhwacsaghteivefll
qlgvpvndkddagwsplhiaasagrdeivkallgkgaqvnavnqngctplhyaasknrhe
iavmllegganpdakdhyeatamhraaakgnlkmihillyykastniqdtegntplhlac
deerveeakllvsqgasiyienkeektplqvakgglglilkrmveg