PDB entry 1tr1

View 1tr1 on RCSB PDB site
Description: crystal structure of e96k mutated beta-glucosidase a from bacillus polymyxa, an enzyme with increased thermoresistance
Class: family 1 beta-glucosidase
Keywords: family 1 beta-glucosidase, increased thermoresistance
Deposited on 1998-03-12, released 1999-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucosidase a
    Species: Paenibacillus polymyxa [TaxId:1406]
    Gene: BGLA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22073 (0-446)
      • mutation (94)
    Domains in SCOPe 2.07: d1tr1a_
  • Chain 'B':
    Compound: beta-glucosidase a
    Species: Paenibacillus polymyxa [TaxId:1406]
    Gene: BGLA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22073 (0-446)
      • mutation (94)
    Domains in SCOPe 2.07: d1tr1b_
  • Chain 'C':
    Compound: beta-glucosidase a
    Species: Paenibacillus polymyxa [TaxId:1406]
    Gene: BGLA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22073 (0-446)
      • mutation (94)
    Domains in SCOPe 2.07: d1tr1c_
  • Chain 'D':
    Compound: beta-glucosidase a
    Species: Paenibacillus polymyxa [TaxId:1406]
    Gene: BGLA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22073 (0-446)
      • mutation (94)
    Domains in SCOPe 2.07: d1tr1d_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tr1A (A:)
    tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
    eedirlmkelgirtyrfsvswprifpngdgevnqkgldyyhrvvdllndngiepfctlyh
    wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
    pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
    tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
    rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
    vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
    rtqvrtpkesyywyrnvvsnnwletrr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tr1B (B:)
    tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
    eedirlmkelgirtyrfsvswprifpngdgevnqkgldyyhrvvdllndngiepfctlyh
    wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
    pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
    tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
    rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
    vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
    rtqvrtpkesyywyrnvvsnnwletrr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tr1C (C:)
    tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
    eedirlmkelgirtyrfsvswprifpngdgevnqkgldyyhrvvdllndngiepfctlyh
    wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
    pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
    tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
    rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
    vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
    rtqvrtpkesyywyrnvvsnnwletrr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tr1D (D:)
    tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
    eedirlmkelgirtyrfsvswprifpngdgevnqkgldyyhrvvdllndngiepfctlyh
    wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
    pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
    tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
    rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
    vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
    rtqvrtpkesyywyrnvvsnnwletrr