PDB entry 1tr1

View 1tr1 on RCSB PDB site
Description: crystal structure of e96k mutated beta-glucosidase a from bacillus polymyxa, an enzyme with increased thermoresistance
Deposited on 1998-03-12, released 1999-04-20
The last revision prior to the SCOP 1.65 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1tr1a_
  • Chain 'B':
    Domains in SCOP 1.65: d1tr1b_
  • Chain 'C':
    Domains in SCOP 1.65: d1tr1c_
  • Chain 'D':
    Domains in SCOP 1.65: d1tr1d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tr1A (A:)
    tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
    eedirlmkelgirtyrfsvswprifpngdgevnqkgldyyhrvvdllndngiepfctlyh
    wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
    pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
    tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
    rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
    vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
    rtqvrtpkesyywyrnvvsnnwletrr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tr1B (B:)
    tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
    eedirlmkelgirtyrfsvswprifpngdgevnqkgldyyhrvvdllndngiepfctlyh
    wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
    pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
    tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
    rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
    vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
    rtqvrtpkesyywyrnvvsnnwletrr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tr1C (C:)
    tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
    eedirlmkelgirtyrfsvswprifpngdgevnqkgldyyhrvvdllndngiepfctlyh
    wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
    pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
    tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
    rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
    vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
    rtqvrtpkesyywyrnvvsnnwletrr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tr1D (D:)
    tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
    eedirlmkelgirtyrfsvswprifpngdgevnqkgldyyhrvvdllndngiepfctlyh
    wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
    pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
    tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
    rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
    vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
    rtqvrtpkesyywyrnvvsnnwletrr