PDB entry 1tr0

View 1tr0 on RCSB PDB site
Description: Crystal Structure of a boiling stable protein SP1
Class: plant protein
Keywords: plant protein
Deposited on 2004-06-18, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0a_
  • Chain 'B':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0b_
  • Chain 'C':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0c_
  • Chain 'D':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0d_
  • Chain 'E':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0e_
  • Chain 'F':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0f_
  • Chain 'G':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0g_
  • Chain 'H':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0h_
  • Chain 'I':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0i_
  • Chain 'J':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0j_
  • Chain 'K':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0k_
  • Chain 'L':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0l_
  • Chain 'M':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0m_
  • Chain 'N':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0n_
  • Chain 'O':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0o_
  • Chain 'P':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0p_
  • Chain 'R':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0r_
  • Chain 'S':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0s_
  • Chain 'T':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0t_
  • Chain 'U':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0u_
  • Chain 'V':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0v_
  • Chain 'W':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0w_
  • Chain 'X':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0x_
  • Chain 'Y':
    Compound: stable protein 1
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tr0y_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tr0A (A:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0A (A:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tr0B (B:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0B (B:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tr0C (C:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0C (C:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tr0D (D:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0D (D:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tr0E (E:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0E (E:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tr0F (F:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0F (F:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1tr0G (G:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0G (G:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1tr0H (H:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0H (H:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1tr0I (I:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0I (I:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1tr0J (J:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0J (J:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1tr0K (K:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0K (K:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1tr0L (L:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0L (L:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1tr0M (M:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0M (M:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1tr0N (N:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0N (N:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1tr0O (O:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0O (O:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1tr0P (P:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0P (P:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1tr0R (R:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0R (R:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1tr0S (S:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0S (S:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1tr0T (T:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0T (T:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1tr0U (U:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0U (U:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1tr0V (V:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0V (V:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1tr0W (W:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0W (W:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1tr0X (X:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0X (X:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1tr0Y (Y:)
    matrtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaeln
    rgythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tr0Y (Y:)
    trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
    ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly