PDB entry 1tqz

View 1tqz on RCSB PDB site
Description: Solution structure of NECAP1 protein
Class: endocytosis/exocytosis
Keywords: NECAP1 protein, endocytosis, structural genomics
Deposited on 2004-06-18, released 2005-07-26
The last revision prior to the SCOP 1.75 freeze date was dated 2005-07-26, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: necap1
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1tqza1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tqzA (A:)
    maaeleyesvlcvkpdvsvyripprasnrgyrasdwkldqpdwtgrlritskgkiayikl
    edkvsgelfaqapveqypgiavetvtdssryfviriqdgtgrsafigigftdrgdafdfn
    vslqdhfkwvkqe