PDB entry 1tqy

View 1tqy on RCSB PDB site
Description: The Actinorhodin Ketosynthase/Chain Length Factor
Class: transferase
Keywords: alpha-beta-alpha-beta-alpha, heterodimer, TRANSFERASE
Deposited on 2004-06-18, released 2004-07-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.233
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-Ketoacyl synthase/Acyl transferase
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Gene: SCO5087 and SCO5088
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1tqya1, d1tqya2
  • Chain 'B':
    Compound: Actinorhodin polyketide putative beta-ketoacyl synthase 2
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCO5088, SCBAC28G1.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1tqyb1, d1tqyb2
  • Chain 'C':
    Compound: Beta-Ketoacyl synthase/Acyl transferase
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Gene: SCO5087 and SCO5088
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1tqyc1, d1tqyc2
  • Chain 'D':
    Compound: Actinorhodin polyketide putative beta-ketoacyl synthase 2
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCO5088, SCBAC28G1.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1tqyd1, d1tqyd2
  • Chain 'E':
    Compound: Beta-Ketoacyl synthase/Acyl transferase
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Gene: SCO5087 and SCO5088
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1tqye1, d1tqye2
  • Chain 'F':
    Compound: Actinorhodin polyketide putative beta-ketoacyl synthase 2
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCO5088, SCBAC28G1.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1tqyf1, d1tqyf2
  • Chain 'G':
    Compound: Beta-Ketoacyl synthase/Acyl transferase
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Gene: SCO5087 and SCO5088
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1tqyg1, d1tqyg2
  • Chain 'H':
    Compound: Actinorhodin polyketide putative beta-ketoacyl synthase 2
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCO5088, SCBAC28G1.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1tqyh1, d1tqyh2
  • Heterogens: NA, MG, ACE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tqyA (A:)
    mkrrvvitgvgvrapggngtrqfwelltsgrtatrrisffdpspyrsqvaaeadfdpvae
    gfgpreldrmdrasqfavacareafaasgldpdtldparvgvslgsavaaatslereyll
    lsdsgrdwevdaawlsrhmfdylvpsvmpaevawavgaegpvtmvstgctsgldsvgnav
    raieegsadvmfagaadtpitpivvacfdairattarnddpehasrpfdgtrdgfvlaeg
    aamfvledydsalargarihaeisgyatrcnayhmtglkadgremaetirvaldesrtda
    tdidyinahgsgtrqndrhetaaykralgeharrtpvssiksmvghslgaigsleiaacv
    lalehgvvpptanlrtsdpecdldyvplearerklrsvltvgsgfggfqsamvlrdaeta
    gaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqyA (A:)
    rrvvitgvgvrapggngtrqfwelltsgrtatrrisffdpspyrsqvaaeadfdpvaegf
    gpreldrmdrasqfavacareafaasgldpdtldparvgvslgsavaaatslereyllls
    dsgrdwevdaawlsrhmfdylvpsvmpaevawavgaegpvtmvstgctsgldsvgnavra
    ieegsadvmfagaadtpitpivvacfdairattarnddpehasrpfdgtrdgfvlaegaa
    mfvledydsalargarihaeisgyatrcnayhmtglkadgremaetirvaldesrtdatd
    idyinahgsgtrqndrhetaaykralgeharrtpvssiksmvghslgaigsleiaacvla
    lehgvvpptanlrtsdpecdldyvplearerklrsvltvgsgfggfqsamvlrdaetaga
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tqyB (B:)
    mdykddddksvlitgvgvvapnglglapywsavldgrhglgpvtrfdvsrypatlagqid
    dfhapdhipgrllpqtdpstrlaltaadwalqdakadpesltdydmgvvtanacggfdft
    hrefrklwsegpksvsvyesfawfyavntgqisirhgmrgpssalvaeqaggldalghar
    rtirrgtplvvsggvdsaldpwgwvsqiasgristatdpdraylpfderaagyvpgegga
    ilvledsaaaeargrhdaygelagcastfdpapgsgrpaglerairlalndagtgpedvd
    vvfadgagvpeldaaearaigrvfgregvpvtvpktttgrlysgggpldvvtalmslreg
    viaptagvtsvpreygidlvlgeprstaprtalvlargrwgfnsaavlrrfaptp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqyB (B:)
    svlitgvgvvapnglglapywsavldgrhglgpvtrfdvsrypatlagqiddfhapdhip
    grllpqtdpstrlaltaadwalqdakadpesltdydmgvvtanacggfdfthrefrklws
    egpksvsvyesfawfyavntgqisirhgmrgpssalvaeqaggldalgharrtirrgtpl
    vvsggvdsaldpwgwvsqiasgristatdpdraylpfderaagyvpgeggailvledsaa
    aeargrhdaygelagcastfdpapgsgrpaglerairlalndagtgpedvdvvfadgagv
    peldaaearaigrvfgregvpvtvpktttgrlysgggpldvvtalmslregviaptagvt
    svpreygidlvlgeprstaprtalvlargrwgfnsaavlrrf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tqyC (C:)
    mkrrvvitgvgvrapggngtrqfwelltsgrtatrrisffdpspyrsqvaaeadfdpvae
    gfgpreldrmdrasqfavacareafaasgldpdtldparvgvslgsavaaatslereyll
    lsdsgrdwevdaawlsrhmfdylvpsvmpaevawavgaegpvtmvstgctsgldsvgnav
    raieegsadvmfagaadtpitpivvacfdairattarnddpehasrpfdgtrdgfvlaeg
    aamfvledydsalargarihaeisgyatrcnayhmtglkadgremaetirvaldesrtda
    tdidyinahgsgtrqndrhetaaykralgeharrtpvssiksmvghslgaigsleiaacv
    lalehgvvpptanlrtsdpecdldyvplearerklrsvltvgsgfggfqsamvlrdaeta
    gaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqyC (C:)
    rrvvitgvgvrapggngtrqfwelltsgrtatrrisffdpspyrsqvaaeadfdpvaegf
    gpreldrmdrasqfavacareafaasgldpdtldparvgvslgsavaaatslereyllls
    dsgrdwevdaawlsrhmfdylvpsvmpaevawavgaegpvtmvstgctsgldsvgnavra
    ieegsadvmfagaadtpitpivvacfdairattarnddpehasrpfdgtrdgfvlaegaa
    mfvledydsalargarihaeisgyatrcnayhmtglkadgremaetirvaldesrtdatd
    idyinahgsgtrqndrhetaaykralgeharrtpvssiksmvghslgaigsleiaacvla
    lehgvvpptanlrtsdpecdldyvplearerklrsvltvgsgfggfqsamvlrdaetaga
    a
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tqyD (D:)
    mdykddddksvlitgvgvvapnglglapywsavldgrhglgpvtrfdvsrypatlagqid
    dfhapdhipgrllpqtdpstrlaltaadwalqdakadpesltdydmgvvtanacggfdft
    hrefrklwsegpksvsvyesfawfyavntgqisirhgmrgpssalvaeqaggldalghar
    rtirrgtplvvsggvdsaldpwgwvsqiasgristatdpdraylpfderaagyvpgegga
    ilvledsaaaeargrhdaygelagcastfdpapgsgrpaglerairlalndagtgpedvd
    vvfadgagvpeldaaearaigrvfgregvpvtvpktttgrlysgggpldvvtalmslreg
    viaptagvtsvpreygidlvlgeprstaprtalvlargrwgfnsaavlrrfaptp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqyD (D:)
    svlitgvgvvapnglglapywsavldgrhglgpvtrfdvsrypatlagqiddfhapdhip
    grllpqtdpstrlaltaadwalqdakadpesltdydmgvvtanacggfdfthrefrklws
    egpksvsvyesfawfyavntgqisirhgmrgpssalvaeqaggldalgharrtirrgtpl
    vvsggvdsaldpwgwvsqiasgristatdpdraylpfderaagyvpgeggailvledsaa
    aeargrhdaygelagcastfdpapgsgrpaglerairlalndagtgpedvdvvfadgagv
    peldaaearaigrvfgregvpvtvpktttgrlysgggpldvvtalmslregviaptagvt
    svpreygidlvlgeprstaprtalvlargrwgfnsaavlrrf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tqyE (E:)
    mkrrvvitgvgvrapggngtrqfwelltsgrtatrrisffdpspyrsqvaaeadfdpvae
    gfgpreldrmdrasqfavacareafaasgldpdtldparvgvslgsavaaatslereyll
    lsdsgrdwevdaawlsrhmfdylvpsvmpaevawavgaegpvtmvstgctsgldsvgnav
    raieegsadvmfagaadtpitpivvacfdairattarnddpehasrpfdgtrdgfvlaeg
    aamfvledydsalargarihaeisgyatrcnayhmtglkadgremaetirvaldesrtda
    tdidyinahgsgtrqndrhetaaykralgeharrtpvssiksmvghslgaigsleiaacv
    lalehgvvpptanlrtsdpecdldyvplearerklrsvltvgsgfggfqsamvlrdaeta
    gaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqyE (E:)
    rrvvitgvgvrapggngtrqfwelltsgrtatrrisffdpspyrsqvaaeadfdpvaegf
    gpreldrmdrasqfavacareafaasgldpdtldparvgvslgsavaaatslereyllls
    dsgrdwevdaawlsrhmfdylvpsvmpaevawavgaegpvtmvstgctsgldsvgnavra
    ieegsadvmfagaadtpitpivvacfdairattarnddpehasrpfdgtrdgfvlaegaa
    mfvledydsalargarihaeisgyatrcnayhmtglkadgremaetirvaldesrtdatd
    idyinahgsgtrqndrhetaaykralgeharrtpvssiksmvghslgaigsleiaacvla
    lehgvvpptanlrtsdpecdldyvplearerklrsvltvgsgfggfqsamvlrdaetaga
    a
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tqyF (F:)
    mdykddddksvlitgvgvvapnglglapywsavldgrhglgpvtrfdvsrypatlagqid
    dfhapdhipgrllpqtdpstrlaltaadwalqdakadpesltdydmgvvtanacggfdft
    hrefrklwsegpksvsvyesfawfyavntgqisirhgmrgpssalvaeqaggldalghar
    rtirrgtplvvsggvdsaldpwgwvsqiasgristatdpdraylpfderaagyvpgegga
    ilvledsaaaeargrhdaygelagcastfdpapgsgrpaglerairlalndagtgpedvd
    vvfadgagvpeldaaearaigrvfgregvpvtvpktttgrlysgggpldvvtalmslreg
    viaptagvtsvpreygidlvlgeprstaprtalvlargrwgfnsaavlrrfaptp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqyF (F:)
    svlitgvgvvapnglglapywsavldgrhglgpvtrfdvsrypatlagqiddfhapdhip
    grllpqtdpstrlaltaadwalqdakadpesltdydmgvvtanacggfdfthrefrklws
    egpksvsvyesfawfyavntgqisirhgmrgpssalvaeqaggldalgharrtirrgtpl
    vvsggvdsaldpwgwvsqiasgristatdpdraylpfderaagyvpgeggailvledsaa
    aeargrhdaygelagcastfdpapgsgrpaglerairlalndagtgpedvdvvfadgagv
    peldaaearaigrvfgregvpvtvpktttgrlysgggpldvvtalmslregviaptagvt
    svpreygidlvlgeprstaprtalvlargrwgfnsaavlrrf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1tqyG (G:)
    mkrrvvitgvgvrapggngtrqfwelltsgrtatrrisffdpspyrsqvaaeadfdpvae
    gfgpreldrmdrasqfavacareafaasgldpdtldparvgvslgsavaaatslereyll
    lsdsgrdwevdaawlsrhmfdylvpsvmpaevawavgaegpvtmvstgctsgldsvgnav
    raieegsadvmfagaadtpitpivvacfdairattarnddpehasrpfdgtrdgfvlaeg
    aamfvledydsalargarihaeisgyatrcnayhmtglkadgremaetirvaldesrtda
    tdidyinahgsgtrqndrhetaaykralgeharrtpvssiksmvghslgaigsleiaacv
    lalehgvvpptanlrtsdpecdldyvplearerklrsvltvgsgfggfqsamvlrdaeta
    gaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqyG (G:)
    rrvvitgvgvrapggngtrqfwelltsgrtatrrisffdpspyrsqvaaeadfdpvaegf
    gpreldrmdrasqfavacareafaasgldpdtldparvgvslgsavaaatslereyllls
    dsgrdwevdaawlsrhmfdylvpsvmpaevawavgaegpvtmvstgctsgldsvgnavra
    ieegsadvmfagaadtpitpivvacfdairattarnddpehasrpfdgtrdgfvlaegaa
    mfvledydsalargarihaeisgyatrcnayhmtglkadgremaetirvaldesrtdatd
    idyinahgsgtrqndrhetaaykralgeharrtpvssiksmvghslgaigsleiaacvla
    lehgvvpptanlrtsdpecdldyvplearerklrsvltvgsgfggfqsamvlrdaetaga
    a
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1tqyH (H:)
    mdykddddksvlitgvgvvapnglglapywsavldgrhglgpvtrfdvsrypatlagqid
    dfhapdhipgrllpqtdpstrlaltaadwalqdakadpesltdydmgvvtanacggfdft
    hrefrklwsegpksvsvyesfawfyavntgqisirhgmrgpssalvaeqaggldalghar
    rtirrgtplvvsggvdsaldpwgwvsqiasgristatdpdraylpfderaagyvpgegga
    ilvledsaaaeargrhdaygelagcastfdpapgsgrpaglerairlalndagtgpedvd
    vvfadgagvpeldaaearaigrvfgregvpvtvpktttgrlysgggpldvvtalmslreg
    viaptagvtsvpreygidlvlgeprstaprtalvlargrwgfnsaavlrrfaptp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqyH (H:)
    svlitgvgvvapnglglapywsavldgrhglgpvtrfdvsrypatlagqiddfhapdhip
    grllpqtdpstrlaltaadwalqdakadpesltdydmgvvtanacggfdfthrefrklws
    egpksvsvyesfawfyavntgqisirhgmrgpssalvaeqaggldalgharrtirrgtpl
    vvsggvdsaldpwgwvsqiasgristatdpdraylpfderaagyvpgeggailvledsaa
    aeargrhdaygelagcastfdpapgsgrpaglerairlalndagtgpedvdvvfadgagv
    peldaaearaigrvfgregvpvtvpktttgrlysgggpldvvtalmslregviaptagvt
    svpreygidlvlgeprstaprtalvlargrwgfnsaavlrrf