PDB entry 1tqx

View 1tqx on RCSB PDB site
Description: Crystal Structure of Pfal009167 A Putative D-Ribulose 5-Phosphate 3-Epimerase from P.falciparum
Class: structural genomics, unknown function
Keywords: Structural Genomics, Protein Structure Initiative, PSI, Structural Genomics of Pathogenic Protozoa Consortium, SGPP, tim barrel, ribulose phosphate epimerase, PSI, Protein Structure Initiative
Deposited on 2004-06-18, released 2004-12-21
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-ribulose-5-phosphate 3-epimerase, putative
    Species: Plasmodium falciparum (isolate 3D7)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1tqxa_
  • Chain 'B':
    Compound: D-ribulose-5-phosphate 3-epimerase, putative
    Species: Plasmodium falciparum (isolate 3D7)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1tqxb_
  • Heterogens: SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tqxA (A:)
    mgtlkaiiapsvlasnisklaeetqrmeslgaewihldvmdmhfvpnlsfgppvinnlkk
    ytksiffdvhlmveypekyvpllktsnqltfhfealnedterciqlakeirdnnlwcgis
    ikpktdvqklvpildtnlintvlvmtvepgfggqsfmhdmmgkvsflrkkyknlniqvdg
    glnietteisashganiivagtsifnaedpkyvidtmrvsvqkylnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqxA (A:)
    lkaiiapsvlasnisklaeetqrmeslgaewihldvmdmhfvpnlsfgppvinnlkkytk
    siffdvhlmveypekyvpllktsnqltfhfealnedterciqlakeirdnnlwcgisikp
    ktdvqklvpildtnlintvlvmtvepgfggqsfmhdmmgkvsflrkkyknlniqvdggln
    ietteisashganiivagtsifnaedpkyvidtmrvsvqky
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tqxB (B:)
    mgtlkaiiapsvlasnisklaeetqrmeslgaewihldvmdmhfvpnlsfgppvinnlkk
    ytksiffdvhlmveypekyvpllktsnqltfhfealnedterciqlakeirdnnlwcgis
    ikpktdvqklvpildtnlintvlvmtvepgfggqsfmhdmmgkvsflrkkyknlniqvdg
    glnietteisashganiivagtsifnaedpkyvidtmrvsvqkylnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqxB (B:)
    lkaiiapsvlasnisklaeetqrmeslgaewihldvmdmhfvpnlsfgppvinnlkkytk
    siffdvhlmveypekyvpllktsnqltfhfealnedterciqlakeirdnnlwcgisikp
    ktdvqklvpildtnlintvlvmtvepgfggqsfmhdmmgkvsflrkkyknlniqvdggln
    ietteisashganiivagtsifnaedpkyvidtmrvsvqky