PDB entry 1tqx

View 1tqx on RCSB PDB site
Description: Crystal Structure of Pfal009167 A Putative D-Ribulose 5-Phosphate 3-Epimerase from P.falciparum
Deposited on 2004-06-18, released 2004-12-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tqxa_
  • Chain 'B':
    Domains in SCOP 1.71: d1tqxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tqxA (A:)
    mgtlkaiiapsvlasnisklaeetqrmeslgaewihldvmdmhfvpnlsfgppvinnlkk
    ytksiffdvhlmveypekyvpllktsnqltfhfealnedterciqlakeirdnnlwcgis
    ikpktdvqklvpildtnlintvlvmtvepgfggqsfmhdmmgkvsflrkkyknlniqvdg
    glnietteisashganiivagtsifnaedpkyvidtmrvsvqkylnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqxA (A:)
    lkaiiapsvlasnisklaeetqrmeslgaewihldvmdmhfvpnlsfgppvinnlkkytk
    siffdvhlmveypekyvpllktsnqltfhfealnedterciqlakeirdnnlwcgisikp
    ktdvqklvpildtnlintvlvmtvepgfggqsfmhdmmgkvsflrkkyknlniqvdggln
    ietteisashganiivagtsifnaedpkyvidtmrvsvqky
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tqxB (B:)
    mgtlkaiiapsvlasnisklaeetqrmeslgaewihldvmdmhfvpnlsfgppvinnlkk
    ytksiffdvhlmveypekyvpllktsnqltfhfealnedterciqlakeirdnnlwcgis
    ikpktdvqklvpildtnlintvlvmtvepgfggqsfmhdmmgkvsflrkkyknlniqvdg
    glnietteisashganiivagtsifnaedpkyvidtmrvsvqkylnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqxB (B:)
    lkaiiapsvlasnisklaeetqrmeslgaewihldvmdmhfvpnlsfgppvinnlkkytk
    siffdvhlmveypekyvpllktsnqltfhfealnedterciqlakeirdnnlwcgisikp
    ktdvqklvpildtnlintvlvmtvepgfggqsfmhdmmgkvsflrkkyknlniqvdggln
    ietteisashganiivagtsifnaedpkyvidtmrvsvqky