PDB entry 1tqt

View 1tqt on RCSB PDB site
Description: Golgi alpha-Mannosidase II In Complex With A Diastereomer of Salacinol
Class: hydrolase
Keywords: N-TERMINAL ALPHA-BETA DOMAIN, THREE HELIX BUNDLE, 2 C-TERMINAL BETA BARRELS, FAMILY 38 GLYCOSYL HYDROLASE, hydrolase
Deposited on 2004-06-18, released 2005-01-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-mannosidase II
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: ALPHA-MAN-II, GMII, CG18474/CG18802/CG8139
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q24451
      • see remark 999 (906)
    Domains in SCOPe 2.08: d1tqta1, d1tqta2, d1tqta3
  • Heterogens: NAG, ZN, SSD, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tqtA (A:)
    rsshhhhhhgefddpirpplkvarsprpgqcqdvvqdvpnvdvqmlelydrmsfkdidgg
    vwkqgwnikydplkynahhklkvfvvphshndpgwiqtfeeyyqhdtkhilsnalrhlhd
    npemkfiwaeisyfarfyhdlgenkklqmksivkngqlefvtggwvmpdeanshwrnvll
    qltegqtwlkqfmnvtptaswaidpfghsptmpyilqksgfknmliqrthysvkkelaqq
    rqleflwrqiwdnkgdtalfthmmpfysydiphtcgpdpkvccqfdfkrmgsfglscpwk
    vpprtisdqnvaarsdllvdqwkkkaelyrtnvlliplgddfrfkqntewdvqrvnyerl
    fehinsqahfnvqaqfgtlqeyfdavhqaeragqaefptlsgdfftyadrsdnywsgyyt
    srpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhhdgitgtakt
    hvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfsyftlddsrwpgsgvedsr
    ttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtdlannpveaqvspvwswhh
    dtltktihpqgsttkyriifkarvppmglatyvltisdskpehtsyasnlllrknptslp
    lgqypedvkfgdpreislrvgngptlafseqgllksiqltqdsphvpvhfkflkygvrsh
    gdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglpsvvhqtimrggapeirnlv
    digsldnteivmrlethidsgdifytdlnglqfikrrrldklplqanyypipsgmfieda
    ntrltlltgqplggsslasgeleimqdrrlasdderglgqgvldnkpvlhiyrlvlekvn
    ncvrpsklhpagyltsaahkasqslldpldkfifaenewigaqgqfggdhpsaredldvs
    vmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchllpnvarcerttltflqnl
    ehldgmvapevcpmetaayvsshss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqtA (A:)
    cqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphsh
    ndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqmk
    sivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghsp
    tmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysyd
    iphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaelyr
    tnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqae
    ragqaefptlsgdfftyadrsdnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdg
    marieerleqarrelslfqhhdgitgtakthvvvdyeqrmqealkacqmvmqqsvyrllt
    kpsiyspdfsfsyftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvd
    fyvsspfvsvtdlannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmgla
    tyvltisdskpehtsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafse
    qgllksiqltqdsphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkg
    klessvsvglpsvvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlng
    lqfikrrrldklplqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrl
    asdderglgqgvldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpld
    kfifaenewigaqgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtp
    eehtqkldvchllpnvarcerttltflqnlehldgmvapevcpmetaayvsshs