PDB entry 1tqq

View 1tqq on RCSB PDB site
Description: Structure of TolC in complex with hexamminecobalt
Class: transport protein
Keywords: Beta-barrel, alpha-barrel, transport protein
Deposited on 2004-06-18, released 2004-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.266
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: outer membrane protein tolc
    Species: Escherichia coli [TaxId:562]
    Gene: TOLC, MTCB, MUKA, REFI, B3035
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tqqa_
  • Chain 'B':
    Compound: outer membrane protein tolc
    Species: Escherichia coli [TaxId:562]
    Gene: TOLC, MTCB, MUKA, REFI, B3035
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tqqb_
  • Chain 'C':
    Compound: outer membrane protein tolc
    Species: Escherichia coli [TaxId:562]
    Gene: TOLC, MTCB, MUKA, REFI, B3035
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tqqc_
  • Heterogens: NCO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tqqA (A:)
    enlmqvyqqarlsnpelrksaadrdaafekinearspllpqlglgadytysngyrdangi
    nsnatsaslqltqsifdmskwraltlqekaagiqdvtyqtdqqtlilntatayfnvlnai
    dvlsytqaqkeaiyrqldqttqrfnvglvaitdvqnaraqydtvlaneltarnnldnave
    qlrqitgnyypelaalnvenfktdkpqpvnallkeaekrnlsllqarlsqdlareqirqa
    qdghlptldltastgisdtsysgsktrgaagtqyddsnmgqnkvglsfslpiyqggmvns
    qvkqaqynfvgaseqlesahrsvvqtvrssfnninasissinaykqavvsaqssldamea
    gysvgtrtivdvldatttlynakqelanarynylinqlniksalgtlneqdllalnnals
    kpvstnpenvapqtpeqnaiadgyapdspapvvqqtsartttsnghnpfrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqqA (A:)
    enlmqvyqqarlsnpelrksaadrdaafekinearspllpqlglgadytysngyrdangi
    nsnatsaslqltqsifdmskwraltlqekaagiqdvtyqtdqqtlilntatayfnvlnai
    dvlsytqaqkeaiyrqldqttqrfnvglvaitdvqnaraqydtvlaneltarnnldnave
    qlrqitgnyypelaalnvenfktdkpqpvnallkeaekrnlsllqarlsqdlareqirqa
    qdghlptldltastgisdtsysgsktrgaagtqyddsnmgqnkvglsfslpiyqggmvns
    qvkqaqynfvgaseqlesahrsvvqtvrssfnninasissinaykqavvsaqssldamea
    gysvgtrtivdvldatttlynakqelanarynylinqlniksalgtlneqdllalnnals
    kpvstnpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tqqB (B:)
    enlmqvyqqarlsnpelrksaadrdaafekinearspllpqlglgadytysngyrdangi
    nsnatsaslqltqsifdmskwraltlqekaagiqdvtyqtdqqtlilntatayfnvlnai
    dvlsytqaqkeaiyrqldqttqrfnvglvaitdvqnaraqydtvlaneltarnnldnave
    qlrqitgnyypelaalnvenfktdkpqpvnallkeaekrnlsllqarlsqdlareqirqa
    qdghlptldltastgisdtsysgsktrgaagtqyddsnmgqnkvglsfslpiyqggmvns
    qvkqaqynfvgaseqlesahrsvvqtvrssfnninasissinaykqavvsaqssldamea
    gysvgtrtivdvldatttlynakqelanarynylinqlniksalgtlneqdllalnnals
    kpvstnpenvapqtpeqnaiadgyapdspapvvqqtsartttsnghnpfrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqqB (B:)
    enlmqvyqqarlsnpelrksaadrdaafekinearspllpqlglgadytysngyrdangi
    nsnatsaslqltqsifdmskwraltlqekaagiqdvtyqtdqqtlilntatayfnvlnai
    dvlsytqaqkeaiyrqldqttqrfnvglvaitdvqnaraqydtvlaneltarnnldnave
    qlrqitgnyypelaalnvenfktdkpqpvnallkeaekrnlsllqarlsqdlareqirqa
    qdghlptldltastgisdtsysgsktrgaagtqyddsnmgqnkvglsfslpiyqggmvns
    qvkqaqynfvgaseqlesahrsvvqtvrssfnninasissinaykqavvsaqssldamea
    gysvgtrtivdvldatttlynakqelanarynylinqlniksalgtlneqdllalnnals
    kpvstnpe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tqqC (C:)
    enlmqvyqqarlsnpelrksaadrdaafekinearspllpqlglgadytysngyrdangi
    nsnatsaslqltqsifdmskwraltlqekaagiqdvtyqtdqqtlilntatayfnvlnai
    dvlsytqaqkeaiyrqldqttqrfnvglvaitdvqnaraqydtvlaneltarnnldnave
    qlrqitgnyypelaalnvenfktdkpqpvnallkeaekrnlsllqarlsqdlareqirqa
    qdghlptldltastgisdtsysgsktrgaagtqyddsnmgqnkvglsfslpiyqggmvns
    qvkqaqynfvgaseqlesahrsvvqtvrssfnninasissinaykqavvsaqssldamea
    gysvgtrtivdvldatttlynakqelanarynylinqlniksalgtlneqdllalnnals
    kpvstnpenvapqtpeqnaiadgyapdspapvvqqtsartttsnghnpfrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqqC (C:)
    enlmqvyqqarlsnpelrksaadrdaafekinearspllpqlglgadytysngyrdangi
    nsnatsaslqltqsifdmskwraltlqekaagiqdvtyqtdqqtlilntatayfnvlnai
    dvlsytqaqkeaiyrqldqttqrfnvglvaitdvqnaraqydtvlaneltarnnldnave
    qlrqitgnyypelaalnvenfktdkpqpvnallkeaekrnlsllqarlsqdlareqirqa
    qdghlptldltastgisdtsysgsktrgaagtqyddsnmgqnkvglsfslpiyqggmvns
    qvkqaqynfvgaseqlesahrsvvqtvrssfnninasissinaykqavvsaqssldamea
    gysvgtrtivdvldatttlynakqelanarynylinqlniksalgtlneqdllalnnals
    kpvstnpe