PDB entry 1tqo

View 1tqo on RCSB PDB site
Description: cryogenic crystal structure of staphylococcal nuclease variant truncated delta+phs i92e
Deposited on 2004-06-17, released 2004-07-06
The last revision prior to the SCOP 1.71 freeze date was dated 2004-07-06, with a file datestamp of 2004-07-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.217
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tqoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tqoA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayeyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsedn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqoA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
    evefdkgqrtdkygrglayeyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
    kkeklniwsed