PDB entry 1tqj

View 1tqj on RCSB PDB site
Description: Crystal structure of D-ribulose 5-phosphate 3-epimerase from Synechocystis to 1.6 angstrom resolution
Deposited on 2004-06-17, released 2004-08-31
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-31, with a file datestamp of 2004-08-31.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.173
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1tqja_
  • Chain 'B':
    Domains in SCOP 1.69: d1tqjb_
  • Chain 'C':
    Domains in SCOP 1.69: d1tqjc_
  • Chain 'D':
    Domains in SCOP 1.69: d1tqjd_
  • Chain 'E':
    Domains in SCOP 1.69: d1tqje_
  • Chain 'F':
    Domains in SCOP 1.69: d1tqjf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tqjA (A:)
    msknivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpl
    tkktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavln
    pstpldfleyvlpvcdlilimsvnpgfggqsfipevlpkiralrqmcdergldpwievdg
    glkpnntwqvleaganaivagsavfnapnyaeaiagvrnskrpepqlatv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqjA (A:)
    knivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpltk
    ktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavlnps
    tpldfleyvlpvcdlilimsvnpqsfipevlpkiralrqmcdergldpwievdgglkpnn
    twqvleaganaivagsavfnapnyaeaiagvrnskrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tqjB (B:)
    msknivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpl
    tkktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavln
    pstpldfleyvlpvcdlilimsvnpgfggqsfipevlpkiralrqmcdergldpwievdg
    glkpnntwqvleaganaivagsavfnapnyaeaiagvrnskrpepqlatv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqjB (B:)
    knivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpltk
    ktldvhlmivepekyvedfakagadiisvhvehnahlhrtlcqirelgkkagavlnpstp
    ldfleyvlpvcdlilimsvnsfipevlpkiralrqmcdergldpwievdgglkpnntwqv
    leaganaivagsavfnapnyaeaiagvrnskrpe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tqjC (C:)
    msknivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpl
    tkktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavln
    pstpldfleyvlpvcdlilimsvnpgfggqsfipevlpkiralrqmcdergldpwievdg
    glkpnntwqvleaganaivagsavfnapnyaeaiagvrnskrpepqlatv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqjC (C:)
    knivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpltk
    ktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavlnps
    tpldfleyvlpvcdlilimsvnqsfipevlpkiralrqmcdergldpwievdgglkpnnt
    wqvleaganaivagsavfnapnyaeaiagvrnskrpep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tqjD (D:)
    msknivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpl
    tkktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavln
    pstpldfleyvlpvcdlilimsvnpgfggqsfipevlpkiralrqmcdergldpwievdg
    glkpnntwqvleaganaivagsavfnapnyaeaiagvrnskrpepqlatv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqjD (D:)
    knivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpltk
    ktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavlnps
    tpldfleyvlpvcdlilimsvnqsfipevlpkiralrqmcdergldpwievdgglkpnnt
    wqvleaganaivagsavfnapnyaeaiagvrnskrp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tqjE (E:)
    msknivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpl
    tkktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavln
    pstpldfleyvlpvcdlilimsvnpgfggqsfipevlpkiralrqmcdergldpwievdg
    glkpnntwqvleaganaivagsavfnapnyaeaiagvrnskrpepqlatv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqjE (E:)
    knivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpltk
    ktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavlnps
    tpldfleyvlpvcdlilimsvnsfipevlpkiralrqmcdergldpwievdgglkpnntw
    qvleaganaivagsavfnapnyaeaiagvrnskrp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tqjF (F:)
    msknivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpl
    tkktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavln
    pstpldfleyvlpvcdlilimsvnpgfggqsfipevlpkiralrqmcdergldpwievdg
    glkpnntwqvleaganaivagsavfnapnyaeaiagvrnskrpepqlatv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqjF (F:)
    knivvapsilsadfsrlgeeikavdeagadwihvdvmdgrfvpnitigplivdairpltk
    ktldvhlmivepekyvedfakagadiisvhvehnasphlhrtlcqirelgkkagavlnps
    tpldfleyvlpvcdlilimsvnpqsfipevlpkiralrqmcdergldpwievdgglkpnn
    twqvleaganaivagsavfnapnyaeaiagvrnskrp