PDB entry 1tqh

View 1tqh on RCSB PDB site
Description: Covalent Reaction intermediate Revealed in Crystal Structure of the Geobacillus stearothermophilus Carboxylesterase Est30
Class: hydrolase
Keywords: carboxylesterase, tetrahedral intermediate, alpha/beta hydrolase, hydrolase
Deposited on 2004-06-17, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxylesterase precursor
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tqha_
  • Heterogens: SO4, 4PA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tqhA (A:)
    mmkivppkpfffeageravlllhgftgnsadvrmlgrfleskgytchapiykghgvppee
    lvhtgpddwwqdvmngyeflknkgyekiavaglslggvfslklgytvpiegivtmcapmy
    ikseetmyegvleyareykkregkseeqieqemekfkqtpmktlkalqeliadvrdhldl
    iyaptfvvqarhdeminpdsaniiyneiespvkqikwyeqsghvitldqekdqlhediya
    flesldw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqhA (A:)
    ppkpfffeageravlllhgftgnsadvrmlgrfleskgytchapiykghgvppeelvhtg
    pddwwqdvmngyeflknkgyekiavaglslggvfslklgytvpiegivtmcapmyiksee
    tmyegvleyareykkregkseeqieqemekfkqtpmktlkalqeliadvrdhldliyapt
    fvvqarhdeminpdsaniiyneiespvkqikwyeqsghvitldqekdqlhediyaflesl
    dw