PDB entry 1tqg

View 1tqg on RCSB PDB site
Description: CheA phosphotransferase domain from Thermotoga maritima
Class: transferase
Keywords: histidine kinase, phosphotransfer, signal transduction, chemotaxis, transferase
Deposited on 2004-06-17, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 0.98 Å
R-factor: N/A
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chemotaxis protein chea
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56310 (4-104)
      • cloning artifact (0-3)
    Domains in SCOPe 2.07: d1tqga1, d1tqga2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tqgA (A:)
    gshmeylgvfvdetkeylqnlndtlleleknpedmelineafralhtlkgmagtmgfssm
    aklchtlenildkarnseikitsdlldkifagvdmitrmvdkivs