PDB entry 1tqg

View 1tqg on RCSB PDB site
Description: CheA phosphotransferase domain from Thermotoga maritima
Class: transferase
Keywords: histidine kinase, phosphotransfer, signal transduction, chemotaxis
Deposited on 2004-06-17, released 2004-09-07
The last revision prior to the SCOP 1.75 freeze date was dated 2004-09-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 0.98 Å
R-factor: 0.18
AEROSPACI score: 1.12 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chemotaxis protein chea
  Species: Thermotoga maritima
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q56310 (4-104)
    • cloning artifact (0-3)
  Domains in SCOP 1.75: d1tqga_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tqgA (A:)
  gshmeylgvfvdetkeylqnlndtlleleknpedmelineafralhtlkgmagtmgfssm
  aklchtlenildkarnseikitsdlldkifagvdmitrmvdkivs