PDB entry 1tqd

View 1tqd on RCSB PDB site
Description: Crystal structure of IIGP1: a paradigm for interferon inducible p47 resistance GTPases
Class: signaling protein
Keywords: GTPase, Interferon gamma, Crystal structure, dimer, immunology, SIGNALING PROTEIN
Deposited on 2004-06-17, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.214
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interferon-inducible GTPase
    Species: Mus musculus [TaxId:10090]
    Gene: IIGP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tqda_
  • Chain 'B':
    Compound: interferon-inducible GTPase
    Species: Mus musculus [TaxId:10090]
    Gene: IIGP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tqdb_
  • Heterogens: SO4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tqdA (A:)
    mgqlfsspksdenndlpssftgyfkkfntgrkiisqeilnlielrmrkgniqltnsaisd
    alkeidssvlnvavtgetgsgkssfintlrgigneeegaaktgvvevtmerhpykhpnip
    nvvfwdlpgigstnfppdtylekmkfyeydffiiisatrfkkndidiakaismmkkefyf
    vrtkvdsditneadgkpqtfdkekvlqdirlncvntfrengiaeppifllsnknvchydf
    pvlmdklisdlpiykrhnfmvslpnitdsviekkrqflkqriwlegfaadlvniipsltf
    lldsdletlkksmkfyrtvfgvdetslqrlardweievdqveamikspavfkptdeetiq
    erlsryiqefclangyllpknsflkeifylkyyfldmvtedaktllkeiclrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqdA (A:)
    ndlpssftgyfkkfntgrkiisqeilnlielrmrkgniqltnsaisdalkeidssvlnva
    vtgetgsgkssfintlrgigneeegaaktgvtmerhpykhpnipnvvfwdlpgigstnfp
    pdtylekmkfyeydffiiisatrfkkndidiakaismmkkefyfvrtkvdsdikekvlqd
    irlncvntfrengiaeppifllsnknvchydfpvlmdklisdlpiykrhnfmvslpnitd
    sviekkrqflkqriwlegfaadlvniipsltflldsdletlkksmkfyrtvfgvdetslq
    rlardweievdqveamikspavfkptdeetiqerlsryiqefclangyllpknsflkeif
    ylkyyfldmvtedaktllkeiclrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tqdB (B:)
    mgqlfsspksdenndlpssftgyfkkfntgrkiisqeilnlielrmrkgniqltnsaisd
    alkeidssvlnvavtgetgsgkssfintlrgigneeegaaktgvvevtmerhpykhpnip
    nvvfwdlpgigstnfppdtylekmkfyeydffiiisatrfkkndidiakaismmkkefyf
    vrtkvdsditneadgkpqtfdkekvlqdirlncvntfrengiaeppifllsnknvchydf
    pvlmdklisdlpiykrhnfmvslpnitdsviekkrqflkqriwlegfaadlvniipsltf
    lldsdletlkksmkfyrtvfgvdetslqrlardweievdqveamikspavfkptdeetiq
    erlsryiqefclangyllpknsflkeifylkyyfldmvtedaktllkeiclrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqdB (B:)
    ndlpssftgyfkkfntgrkiisqeilnlielrmrkgniqltnsaisdalkeidssvlnva
    vtgetgsgkssfintlrgigneeegaakttmerhpykhpnipnvvfwdlpgidtylekmk
    fyeydffiiisatrfkkndidiakaismmkkefyfvrtkvdsditnekekvlqdirlncv
    ntfrengiaeppifllsnknvchydfpvlmdklisdlpiykrhnfmvslpnitdsviekk
    rqflkqriwlegfaadlvniipsltflldsdletlkksmkfyrtvfgvdetslqrlardw
    eievdqveamikspavfkptdeetiqerlsryiqefclangyllpknsflkeifylkyyf
    ldmvtedaktllkeiclrn