PDB entry 1tqc

View 1tqc on RCSB PDB site
Description: Ovine recombinant PrP(114-234), ARR variant in complex with the VRQ14 Fab fragment (IgG2a)
Class: unknown function/immune system
Keywords: prion, antibody, UNKNOWN FUNCTION/IMMUNE SYSTEM COMPLEX
Deposited on 2004-06-17, released 2004-07-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.222
AEROSPACI score: -1.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prion protein
    Species: Ovis aries [TaxId:9940]
    Gene: PRNP sheep ARR variant
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1tqca_
  • Chain 'B':
    Compound: VRQ14 Fab Heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1TQC (0-211)
    Domains in SCOPe 2.05: d1tqcb1, d1tqcb2
  • Chain 'C':
    Compound: VRQ14 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1TQC (0-218)
    Domains in SCOPe 2.05: d1tqcc1, d1tqcc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tqcA (A:)
    glggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdrysnqnnfvhdcvnit
    vkqhtvttttkgenftetdikimervveqmcitqyqresqay
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tqcB (B:)
    qiqlvqsgpelkkpgetvkisckasgytftnygmnlvkqapgkgfewmgwintftgepty
    addfkgrfvfsldtsastaylqinnlknedtatyfftrgtdywgqgttltvssakttaps
    vyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsss
    vtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tqcC (C:)
    dvvmsqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvsrld
    sgvpdrftgsgsgtdftlkisrveaedlgiyfcwqgshfpqtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec