PDB entry 1tqb

View 1tqb on RCSB PDB site
Description: Ovine recombinant PrP(114-234), VRQ variant in complex with the Fab of the VRQ14 antibody
Class: unknown function/immune system
Keywords: prion, antibody, UNKNOWN FUNCTION/IMMUNE SYSTEM COMPLEX
Deposited on 2004-06-17, released 2004-07-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.214
AEROSPACI score: -1.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prion protein
    Species: Ovis aries [TaxId:9940]
    Gene: PRNP sheep VRQ variant
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23907 (0-101)
      • see remark 999 (9)
      • see remark 999 (44)
    Domains in SCOPe 2.05: d1tqba_
  • Chain 'B':
    Compound: VRQ14 Fab Heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1TQB (0-211)
    Domains in SCOPe 2.05: d1tqbb1, d1tqbb2
  • Chain 'C':
    Compound: VRQ14 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1TQB (0-218)
    Domains in SCOPe 2.05: d1tqbc1, d1tqbc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tqbA (A:)
    glggymlgsvmsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvnit
    vkqhtvttttkgenftetdikimervveqmcitqyqresqay
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tqbB (B:)
    qiqlvqsgpelkkpgetvkisckasgytftnygmnlvkqapgkgfewmgwintftgepty
    addfkgrfvfsldtsastaylqinnlknedtatyfftrgtdywgqgttltvssakttaps
    vyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsss
    vtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tqbC (C:)
    dvvmsqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvsrld
    sgvpdrftgsgsgtdftlkisrveaedlgiyfcwqgshfpqtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec