PDB entry 1tq8

View 1tq8 on RCSB PDB site
Description: Crystal Structure of protein Rv1636 from Mycobacterium tuberculosis H37Rv
Class: structural genomics, unknown function
Keywords: HypotheticalProtein, RV1636, MTCY01B2.28, MT1672, STRUCTURAL GENOMICS TARGET, T1533, NYSGXRC, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2004-06-16, released 2004-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein Rv1636
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1636
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06153 (14-158)
      • cloning artifact (12-13)
      • modified residue (30)
    Domains in SCOPe 2.08: d1tq8a1, d1tq8a2
  • Chain 'B':
    Compound: hypothetical protein Rv1636
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1636
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06153 (14-158)
      • cloning artifact (12-13)
      • modified residue (30)
    Domains in SCOPe 2.08: d1tq8b1, d1tq8b2
  • Chain 'C':
    Compound: hypothetical protein Rv1636
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1636
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06153 (14-158)
      • cloning artifact (12-13)
      • modified residue (30)
    Domains in SCOPe 2.08: d1tq8c1, d1tq8c2
  • Chain 'D':
    Compound: hypothetical protein Rv1636
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1636
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06153 (14-158)
      • cloning artifact (12-13)
      • modified residue (30)
    Domains in SCOPe 2.08: d1tq8d1, d1tq8d2
  • Chain 'E':
    Compound: hypothetical protein Rv1636
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1636
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06153 (14-158)
      • cloning artifact (12-13)
      • modified residue (30)
    Domains in SCOPe 2.08: d1tq8e1, d1tq8e2
  • Chain 'F':
    Compound: hypothetical protein Rv1636
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1636
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06153 (14-158)
      • cloning artifact (12-13)
      • modified residue (30)
    Domains in SCOPe 2.08: d1tq8f1, d1tq8f2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tq8A (A:)
    mghhhhhhgghmslsayktvvvgtdgsdssmravdraaqiagadakliiasaylpqheda
    raadilkdesykvtgtapiyeilhdakerahnagaknveerpivgapvdalvnladeeka
    dllvvgnvglstiagrllgsvpanvsrrakvdvlivhtteggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tq8A (A:)
    slsayktvvvgtdgsdssmravdraaqiagadakliiasaylptapiyeilhdakerahn
    agaknveerpivgapvdalvnladeekadllvvgnvglstiagrllgsvpanvsrrakvd
    vlivhtt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tq8B (B:)
    mghhhhhhgghmslsayktvvvgtdgsdssmravdraaqiagadakliiasaylpqheda
    raadilkdesykvtgtapiyeilhdakerahnagaknveerpivgapvdalvnladeeka
    dllvvgnvglstiagrllgsvpanvsrrakvdvlivhtteggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tq8B (B:)
    slsayktvvvgtdgsdssmravdraaqiagadakliiasaylptapiyeilhdakerahn
    agaknveerpivgapvdalvnladeekadllvvgnvglstiagrllgsvpanvsrrakvd
    vlivhtt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tq8C (C:)
    mghhhhhhgghmslsayktvvvgtdgsdssmravdraaqiagadakliiasaylpqheda
    raadilkdesykvtgtapiyeilhdakerahnagaknveerpivgapvdalvnladeeka
    dllvvgnvglstiagrllgsvpanvsrrakvdvlivhtteggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tq8C (C:)
    slsayktvvvgtdgsdssmravdraaqiagadakliiasaylptapiyeilhdakerahn
    agaknveerpivgapvdalvnladeekadllvvgnvglstiagrllgsvpanvsrrakvd
    vlivhtt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tq8D (D:)
    mghhhhhhgghmslsayktvvvgtdgsdssmravdraaqiagadakliiasaylpqheda
    raadilkdesykvtgtapiyeilhdakerahnagaknveerpivgapvdalvnladeeka
    dllvvgnvglstiagrllgsvpanvsrrakvdvlivhtteggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tq8D (D:)
    slsayktvvvgtdgsdssmravdraaqiagadakliiasaylptapiyeilhdakerahn
    agaknveerpivgapvdalvnladeekadllvvgnvglstiagrllgsvpanvsrrakvd
    vlivhtt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tq8E (E:)
    mghhhhhhgghmslsayktvvvgtdgsdssmravdraaqiagadakliiasaylpqheda
    raadilkdesykvtgtapiyeilhdakerahnagaknveerpivgapvdalvnladeeka
    dllvvgnvglstiagrllgsvpanvsrrakvdvlivhtteggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tq8E (E:)
    slsayktvvvgtdgsdssmravdraaqiagadakliiasaylpapiyeilhdakerahna
    gaknveerpivgapvdalvnladeekadllvvgnvglstiagrllgsvpanvsrrakvdv
    livhtt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tq8F (F:)
    mghhhhhhgghmslsayktvvvgtdgsdssmravdraaqiagadakliiasaylpqheda
    raadilkdesykvtgtapiyeilhdakerahnagaknveerpivgapvdalvnladeeka
    dllvvgnvglstiagrllgsvpanvsrrakvdvlivhtteggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tq8F (F:)
    slsayktvvvgtdgsdssmravdraaqiagadakliiasaylptapiyeilhdakerahn
    agaknveerpivgapvdalvnladeekadllvvgnvglstiagrllgsvpanvsrrakvd
    vlivhtt