PDB entry 1tq7

View 1tq7 on RCSB PDB site
Description: Crystal structure of the anticoagulant thrombin mutant W215A/E217A bound to PPACK
Class: hydrolase/hydrolase inhibitor
Keywords: thrombin, anticoagulant, BLOOD CLOTTING, PPACK, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2004-06-16, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.205
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prothrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tq7.1
  • Chain 'B':
    Compound: Prothrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-256)
      • engineered (226)
      • engineered (228)
    Domains in SCOPe 2.07: d1tq7.1
  • Heterogens: ZN, 0G6, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tq7A (A:)
    yqtffnprtfgsgeadcglrplfekksledkterellesyidgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tq7B (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivsagagcdrdgkygfy
    thvfrlkkwiqkvidqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tq7B (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketkgqpsvlqvvnlpiverpvckdstriritdnmf
    cagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivsagagcdrdgkygfythvfrl
    kkwiqkvidqf