PDB entry 1tq5

View 1tq5 on RCSB PDB site
Description: Crystal Structure of YhhW from Escherichia coli
Class: unknown function
Keywords: bicupin, pirin, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-06-16, released 2005-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.7600000000000002 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein yhhW
    Species: Escherichia coli [TaxId:562]
    Gene: YHHW, B3439
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46852 (0-230)
      • modified residue (0)
      • modified residue (34)
      • modified residue (61)
      • modified residue (78)
      • modified residue (92)
      • modified residue (119)
      • modified residue (159)
      • expression tag (236-238)
    Domains in SCOPe 2.08: d1tq5a1, d1tq5a2
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tq5A (A:)
    miylrkanerghanhgwldswhtfsfanyydpnfmgfsalrvinddvieagqgfgthphk
    dmeiltyvlegtvehqdsmgnkeqvpagefqimsagtgirhseynpssterlhlyqiwim
    peengitpryeqrrfdavqgkqlvlspdardgslkvhqdmelyrwallkdeqsvhqiaae
    rrvwiqvvkgnvtingvkastsdglaiwdeqaisihadsdsevllfdlppvsgrvehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tq5A (A:)
    miylrkanerghanhgwldswhtfsfanyydpnfmgfsalrvinddvieagqgfgthphk
    dmeiltyvlegtvehqdsmgnkeqvpagefqimsagtgirhseynpssterlhlyqiwim
    peengitpryeqrrfdavqgkqlvlspdardgslkvhqdmelyrwallkdeqsvhqiaae
    rrvwiqvvkgnvtingvkastsdglaiwdeqaisihadsdsevllfdlppvhhh