PDB entry 1tq4

View 1tq4 on RCSB PDB site
Description: Crystal Structure of IIGP1: a paradigm for interferon inducible p47 resistance GTPases
Deposited on 2004-06-16, released 2004-09-21
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-21, with a file datestamp of 2004-09-21.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.193
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1tq4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tq4A (A:)
    mgqlfsspksdenndlpssftgyfkkfntgrkiisqeilnlielrmragniqltnsaisd
    alkeidssvlnvavtgetgsgkssfintlrgigneeegaaktgvvevtmerhpykhpnip
    nvvfwdlpgigstnfppdtylekmkfyeydffiiisatrfkkndidiakaismmkkefyf
    vrtkvdsditneadgepqtfdkekvlqdirlncvntfrengiaeppifllsnknvchydf
    pvlmdklisdlpiykrhnfmvslpnitdsviekkrqflkqriwlegfaadlvniipsltf
    lldsdletlkksmkfyrtvfgvdetslqrlardweievdqveamikspavfkptdeetiq
    erlsryiqefclangyllpknsflkeifylkyyfldmvtedaktllkeiclrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tq4A (A:)
    ndlpssftgyfkkfntgrkiisqeilnlielrmragniqltnsaisdalkeidssvlnva
    vtgetgsgkssfintlrgigneeegaaktgvmerhpykhpnipnvvfwdlpgigstnfpp
    dtylekmkfyeydffiiisatrfkkndidiakaismmkkefyfvrtkvdsditneadgep
    qtfdkekvlqdirlncvntfrengiaeppifllsnknvchydfpvlmdklisdlpiykrh
    nfmvslpnitdsviekkrqflkqriwlegfaadlvniipsltflldsdletlkksmkfyr
    tvfgvdetslqrlardweievdqveamikspavfkptdeetiqerlsryiqefclangyl
    lpknsflkeifylkyyfldmvtedaktllkeiclrn