PDB entry 1tq3

View 1tq3 on RCSB PDB site
Description: Higher resolution crystal structure of the third PDZ domain of post synaptic PSD-95 protein
Class: peptide binding protein
Keywords: peptide binding protein
Deposited on 2004-06-16, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Presynaptic density protein 95
    Species: Rattus norvegicus [TaxId:10116]
    Gene: DLG4, DLGH4, PSD95
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31016 (Start-105)
      • cloning artifact (106-118)
    Domains in SCOPe 2.07: d1tq3a2, d1tq3a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tq3A (A:)
    gspeflgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkg
    dqilsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvdssgrivtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tq3A (A:)
    dipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqilsvngv
    dlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvdssgrivtd