PDB entry 1tq3
View 1tq3 on RCSB PDB site
Description: Higher resolution crystal structure of the third PDZ domain of post synaptic PSD-95 protein
Class: peptide binding protein
Keywords: peptide binding protein
Deposited on
2004-06-16, released
2005-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-07-08.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.238
AEROSPACI score: 0.42
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Presynaptic density protein 95
Species: Rattus norvegicus [TaxId:10116]
Gene: DLG4, DLGH4, PSD95
Database cross-references and differences (RAF-indexed):
- Uniprot P31016 (Start-105)
- cloning artifact (106-118)
Domains in SCOPe 2.06: d1tq3a2, d1tq3a3 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1tq3A (A:)
gspeflgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkg
dqilsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvdssgrivtd
Sequence, based on observed residues (ATOM records): (download)
>1tq3A (A:)
dipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqilsvngv
dlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvdssgrivtd